missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198855

Invitrogen™ Human BRF2 (aa 39-108) Control Fragment Recombinant Protein

Product Code. 30198855
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198855

Brand: Invitrogen™ RP93748

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82829 (PA5-82829. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HAW0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55290
Name Human BRF2 (aa 39-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700059M06Rik; 5730512K07Rik; AU018504; AU022602; B-related factor 2; BRF2; BRF-2; BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit; BRF2, RNA polymerase III transcription initiation factor 50 subunit; BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like; BRFU; FLJ11052; hBRFU; hTFIIIB50; PRO1470; RNA polymerase III transcription initiation factor BRFU; TFIIIB50; transcription factor IIB- related factor, TFIIIB50; transcription factor IIIB 50 kDa subunit
Common Name BRF2
Gene Symbol Brf2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.