Invitrogen™ Human BRF1 (aa 441-517) Control Fragment Recombinant Protein

Product Code. 30210371

Brand: Invitrogen™ RP109448

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA polymerase (pol) III synthesizes tRNA, 5s rRNA, 7SL RNA and U6 snRNA and is overexpressed in many transformed cell lines and tumors in vivo, since cells must duplicate its protein components before division. Therefore, in order to maintain rapid growth, cells must produce a high level of Pol III transcribed RNA, which requires the presence of the TFIIIB and TFIIIC2 transcription factor complexes. The TFIIIC2 complex is composed of five subunits, TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, that are overexpressed in adenovirus transformed cells as well as in malignant cells in vivo, such as ovarian carcinomas. TFIIIC2 recruits RNA pol III and TFIIIB to promoter elements and may be a key component in the deregulation of malignant cells. The TFIIIB complex includes the TATA-binding protein (TBP), TFIIB-related factor 1 (TFIIIB90, BRF1) and TFIIIB, the expression of which are also upregulated in transformed cells. In many carcinomas, the tumor suppressors retinoblastoma (RB) and p53 are inactivated, which affects their ability to bind and inactivate the function of TFIIIB.

Specifications

• Accession Number: Q92994
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2972
• Name: Human BRF1 (aa 441-517) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510002F24Rik; B - related factor 1; Berg36; B-related factor 1; BRF; BRF1; BRF-1; BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB; BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae); BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit; BRF1, RNA polymerase III transcription initiation factor 90 subunit; butyrate response factor 1; CFDS; cMG1; early response factor Berg36; EGF-response factor 1; epididymis secretory sperm binding protein Li 76 p; ERF1; ERF-1; general transcription factor IIIB, 90 kD subunit; GTF3B; hBRF; HEL-S-76 p; hTFIIIB90; mRNA decay activator protein ZFP36L1; mTFIIIB90; RNF162B; TAF3B2; TAF3C; TAFIII90; TATA box binding protein (TBP)-associated factor 3 C; TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2; TATA box-binding protein-associated factor, RNA polymerase III, subunit 2; TBP - associated factor, RNA polymerase III, 90 kD; TF3B90; TFIIIB90; TIS11B; TPA-induced sequence 11 b; Transcription factor IIIB 90 kDa subunit; ZFP36 ring finger protein like 1; ZFP36 ring finger protein-like 1; ZFP36L1; ZFP36-like 1; zinc finger protein 36, C3H type-like 1; zinc finger protein 36, C3H1 type-like 1; zinc finger protein, C3H type, 36-like 1
• Common Name: BRF1
• Gene Symbol: BRF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining