Invitrogen™ Human Brevican (aa 223-354) Control Fragment Recombinant Protein

Product Code. 30208501

Brand: Invitrogen™ RP89912

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52477 (PA5-52477. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Brevican is the most abundant chondroitin sulfate proteoglycan in the extracellular matrix of the adult brain. It is a member of the lectican family of aggregating extracellular matrix proteoglycans that bear chondroitin sulfate (CS) chains. It is highly expressed in the central nervous system and is thought to stabilize synapses and inhibit neural plasticity. Brevican is secreted from astrocytes and neurons as a 145 kD core protein that bears up to three, covalently-linked, CS chains. It is also is secreted as a 145 kD core protein without CS chains. When cleaved by extracellular glutamyl endopeptidases, the ADAMTSs, a 55 kD N-terminal fragment is formed that contains the unique C terminal epitope EAMESE.

Specifications

• Accession Number: Q96GW7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63827
• Name: Human Brevican (aa 223-354) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALPBRE; Bcan; Behab; Brain-enriched hyaluronan-binding protein; brevican; brevican (brain specific proteoglycan in the aggrecan family); brevican core protein; Chondroitin sulfate proteoglycan 7; chondroitin sulfate proteoglycan BEHAB; CSPG7; UNQ2525/PRO6018
• Common Name: Brevican
• Gene Symbol: Bcan
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining