Invitrogen™ Human BRD8 (aa 577-723) Control Fragment Recombinant Protein

Product Code. 30198138

Brand: Invitrogen™ RP95152

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81974 (PA5-81974. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional repressor that contribute to growth arrest during terminal macrophage differentiation by repressing target genes involved in Ras-dependent proliferation. Represses MMP1 promoter activity.

Specifications

• Accession Number: Q9H0E9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10902
• Name: Human BRD8 (aa 577-723) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610007E11Rik; 4432404P07Rik; BRD8; bromodomain containing 8; bromodomain-containing protein 8; LOW QUALITY PROTEIN: bromodomain-containing protein 8; p120; Skeletal muscle abundant protein; Skeletal muscle abundant protein 2; SMAP; SMAP2; Thyroid hormone receptor coactivating protein of 120 kDa; trCP120
• Common Name: BRD8
• Gene Symbol: BRD8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVWRAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining