Invitrogen™ Human BRD3 (aa 140-211) Control Fragment Recombinant Protein

Product Code. 30201053

Brand: Invitrogen™ RP101454

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84088 (PA5-84088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known.

Specifications

• Accession Number: Q15059
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8019
• Name: Human BRD3 (aa 140-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410084F24Rik; AW060456; BRD3; bromodomain containing 3; bromodomain containing 3; bromodomain-containing protein 3; bromodomain containing protein 3; bromodomain-containing 3; bromodomain-containing FSH-like protein FSRG2; Bromodomain-containing protein 3; bromodomain-containing protein 3 short isoform; Fsrg2; KIAA0043; ORFX; RING3L; RING3-like protein; RINGL3
• Common Name: BRD3
• Gene Symbol: BRD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining