missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BRD2 (aa 179-259) Control Fragment Recombinant Protein

Product Code. 30182484
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182484

Brand: Invitrogen™ RP99496

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83631 (PA5-83631. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatibility complex (MHC) class II region on chromosome 6p21. 3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene, but the full-length nature of some of these variants has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P25440
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6046
Name Human BRD2 (aa 179-259) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW228947; Brd2; bromodomain containing 2; bromodomain-containing 2; bromodomain-containing protein 2; D17H6S113E; D6S113E; DADB-17J1.3; DKFZp686N0336; female sterile homeotic-related gene 1; Female sterile homeotic-related protein 1; FLJ31942; Frg-1; FSH; Fsrg1; Fsrg-1; Kiaa4005; KIAA9001; mKIAA4005; Nat; O27.1.1; Protein RING3; Really interesting new gene 3 protein; RING3; RING3 protein; Rnf3
Common Name BRD2
Gene Symbol BRD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.