Invitrogen™ Human BRCC3 (aa 131-267) Control Fragment Recombinant Protein

Product Code. 30208905

Brand: Invitrogen™ RP106198

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65526 (PA5-65526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Together with the breast and ovarian predisposition proteins BRCA1 and BRCA2 and RAD51 and BRCC45, BRCC36 forms a holoenzyme complex that possesses a ubiquitin E3 ligase activity. Aberrant levels of BRCC36 were detected in sporadic breast tumors and depletion of either BRCC36 or BRCC45 by siRNA resulted in increased sensitivity to ionizing radiation and defects in the G2/M checkpoint, indicating that BRCC36 acts to enhance cellular survival following DNA damage. Recent experiments have shown that BRCC36 is essential for ionizing radiation-induced BRCA1 phosphorylation and nuclear foci formation, suggesting that BRCC36 may be an important target in the treatment of radiation-resistant breast tumors. At least two isoforms of BRCC36 are known to exist.

Specifications

• Accession Number: P46736
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79184
• Name: Human BRCC3 (aa 131-267) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6.1 A protein; BRCA1/BRCA2-containing complex subunit 3; BRCA1/BRCA2-containing complex subunit 36; BRCA1/BRCA2-containing complex, subunit 3; BRCA1-A complex subunit BRCC36; Brcc3; BRCC36; BRISC complex subunit BRCC36; C6.1 A; CXorf53; lys-63-specific deubiquitinase BRCC36; RP11-143H17.2
• Common Name: BRCC3
• Gene Symbol: BRCC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining