missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205367

Invitrogen™ Human BRCAA1 (aa 729-825) Control Fragment Recombinant Protein

Product Code. 30205367
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205367

Brand: Invitrogen™ RP93994

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82965 (PA5-82965. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of C18orf25 remains unknown. There are two named isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q4LE39
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51742
Name Human BRCAA1 (aa 729-825) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 180 kDa Sin3-associated polypeptide; ARID domain-containing protein 4 B; ARID4B; AT rich interactive domain 4 B (Rbp1 like); AT rich interactive domain 4 B (RBP1-like); AT-rich interaction domain 4 B; AT-rich interactive domain-containing protein 4 B; Bcaa; BRCAA1; breast cancer-associated antigen; breast cancer-associated antigen 1; breast cancer-associated antigen BRCAA1; breast carcinoma-associated antigen; histone deacetylase complex subunit SAP180; Rb-binding protein homolog; RBBP1L1; RBP1L1; retinoblastoma binding protein 1-like 1; retinoblastoma-binding protein 1-like 1; retinoblastoma-binding protein 1-related protein; Sap180; SIN3A-associated protein 180; Sin3-associated polypeptide p180
Common Name BRCAA1
Gene Symbol ARID4B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.