missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BRAF35 (aa 25-78) Control Fragment Recombinant Protein

Product Code. 30210566
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210566

Brand: Invitrogen™ RP104193

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for correct progression through G2 phase of the cell cycle and entry into mitosis. Required for RCOR1/CoREST mediated repression of neuronal specific gene promoters.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P15056, Q9P0W2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10362, 673
Name Human BRAF35 (aa 25-78) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW610687; BRAF25; BRAF35; BRCA2-associated factor 35; fc85b02; FLJ26127; high mobility group 20 B; high mobility group 20 B; high mobility group box domain containing; high mobility group protein 20 B; high-mobility group 20 B; HMG box domain containing 2; HMG box-containing protein 20 B; HMG domain-containing protein 2; HMG domain-containing protein HMG x 2; HMG20B; Hmg x 2; HMGXB2; hypothetical protein LOC553572; PP7706; pp8857; si:dkey-110c1.6; SMARCE1R; SMARCE1-related protein; SOXL; Sox-like transcriptional factor; Structural DNA-binding protein BRAF35; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related; LOW QUALITY PROTEIN: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E, member 1-related; Unknown (protein for MGC:134468); wu:fc85b02; zgc:110001
Common Name BRAF35
Gene Symbol BRAF, HMG20B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.