missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BNIP1 (aa 86-203) Control Fragment Recombinant Protein

Product Code. 30212181
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212181

Brand: Invitrogen™ RP104555

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82335 (PA5-82335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NIP1 (BNIP1) is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four products of unknown function. Transcript variant BNIP1 contains the entire coding region of the gene. This variant contains a fully conserved BH3 domain, which has been associated with pro-apoptotic function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12981
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 662
Name Human BNIP1 (aa 86-203) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010005M06Rik; 5930429G21Rik; BCL2 interacting protein 1; BCL2/adenovirus E1B 19 kDa protein-interacting protein 1; BCL2/adenovirus E1B 19 kD interacting protein 1; BCL2/adenovirus E1B 19 kDa interacting protein 1; BCL2/adenovirus E1B 19 kDa-interacting protein 1; BCL2/adenovirus E1B 19 kDa-interacting protein 1, NIP1; BCL2/adenovirus E1B interacting protein 1; BCL2/adenovirus E1B interacting protein 1, NIP1; BCL2/adenovirus E1B interacting protein 1-like 1; bnip1; bnip1 {ECO:0000312; Bnip1l1; EMBL:AAL50991.1, ECO:0000312; NIP1; RGD:620799}; Sec20; Sec20l; SNARE protein SEC20; transformation-related gene 8 protein; TRG8; TRG-8; Unknown (protein for MGC:133975); vesicle transport protein SEC20
Common Name BNIP1
Gene Symbol BNIP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.