Invitrogen™ Human BNIP1 (aa 86-203) Control Fragment Recombinant Protein

Product Code. 30212181

Brand: Invitrogen™ RP104555

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82335 (PA5-82335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NIP1 (BNIP1) is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four products of unknown function. Transcript variant BNIP1 contains the entire coding region of the gene. This variant contains a fully conserved BH3 domain, which has been associated with pro-apoptotic function.

Specifications

• Accession Number: Q12981
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 662
• Name: Human BNIP1 (aa 86-203) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010005M06Rik; 5930429G21Rik; BCL2 interacting protein 1; BCL2/adenovirus E1B 19 kDa protein-interacting protein 1; BCL2/adenovirus E1B 19 kD interacting protein 1; BCL2/adenovirus E1B 19 kDa interacting protein 1; BCL2/adenovirus E1B 19 kDa-interacting protein 1; BCL2/adenovirus E1B 19 kDa-interacting protein 1, NIP1; BCL2/adenovirus E1B interacting protein 1; BCL2/adenovirus E1B interacting protein 1, NIP1; BCL2/adenovirus E1B interacting protein 1-like 1; bnip1; bnip1 {ECO:0000312; Bnip1l1; EMBL:AAL50991.1, ECO:0000312; NIP1; RGD:620799}; Sec20; Sec20l; SNARE protein SEC20; transformation-related gene 8 protein; TRG8; TRG-8; Unknown (protein for MGC:133975); vesicle transport protein SEC20
• Common Name: BNIP1
• Gene Symbol: BNIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining