Invitrogen™ Human BNC1 (aa 779-866) Control Fragment Recombinant Protein

Product Code. 30198939

Brand: Invitrogen™ RP107218

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66563 (PA5-66563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bnc 1 is a 994 amino acid transcription factor specific for squamous epithelium and for the constituent keratinocytes at a stage either prior to or at the very beginning of terminal differentiation. It is a zinc finger protein with three separated pairs of zinc fingers and a nuclear localization signal. Bnc 1 is a soluble protein that can shuttle between the nucleus and the cytoplasm, and its location depends on the proliferative potential of the cell. It is expressed relatively uniformly in the nucleoplasm, and phosphorylation on Ser-537 and Ser-541 leads to its cytoplasmic localization. It is present in the basal cell layer of the epidermis, in hair follicles and also in abundance in the germ cells of testis and ovary, and to a lower extent in thymus, spleen, mammary glands, placenta, brain and heart. Reports suggest that it plays a regulatory role in keratinocyte proliferation and also in rRNA transcription. It is also known to play a role in the differentiation of spermatozoa and oocytes.

Specifications

• Accession Number: Q01954
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 646
• Name: Human BNC1 (aa 779-866) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI047752; AW546376; basonuclin 1; BNC; bnc 1; Bnc1; BSN1; HsT19447; zinc finger protein basonuclin-1
• Common Name: BNC1
• Gene Symbol: BNC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining