missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BMP-7 (aa 279-333) Control Fragment Recombinant Protein

Product Code. 30209818
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209818

Brand: Invitrogen™ RP105084

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extra skeletal site. Based on its expression early in embryogenesis, BMP7 has a proposed role in early development. In addition, the fact that BMP7 is closely related to BMP5 and BMP6 has lead to speculation of possible bone inductive activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P18075
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 655
Name Human BMP-7 (aa 279-333) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BMP; BMP7; BMP-7; bone moorphogenic protein-7; Bone morphogenetic protein; bone morphogenetic protein 7; bone morphogenetic protein 7 (osteogenic protein 1); bone morphogenetic protein 7 preproprotein; bone morphogenic protein 7; Eptotermin alfa; OP1; OP-1; Osteogenic protein 1; RP11-560A15.5
Common Name BMP-7
Gene Symbol Bmp7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.