Invitrogen™ Human BLZF1 Control Fragment Recombinant Protein

Product Code. 30209774

Brand: Invitrogen™ RP94117

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface.

Specifications

• Accession Number: Q9H2G9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8548
• Name: Human BLZF1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700030G05Rik; Basic leucine zipper nuclear factor 1; basic leucine zipper nuclear factor 1 (JEM-1); Blzf1; blzf1 protein; Blzf1l; cytoplasmic protein; fe06a04; Golgin45; Golgin-45; Golgin-45; golgin-45; JEM1; JEM-1; JEM-1 s; JEM-1 short protein; LOC504820 protein; MGC22497; p45 basic leucine-zipper nuclear factor; wu:fe06a04; zgc:66280; zgc:85871
• Common Name: BLZF1
• Gene Symbol: BLZF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVRSRKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEVKAVRI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining