Invitrogen™ Human BLOC1S1 (aa 33-147) Control Fragment Recombinant Protein

Product Code. 30205307

Brand: Invitrogen™ RP91631

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54395 (PA5-54395. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 ).

Specifications

• Accession Number: P78537
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2647
• Name: Human BLOC1S1 (aa 33-147) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI839753; biogenesis of lysosomal organelles complex 1 subunit 1; biogenesis of lysosomal organelles complex-1, subunit 1; biogenesis of lysosome-related organelles complex 1 subunit 1; biogenesis of lysosome-related organelles complex 1 subunit 1-like; biogenesis of lysosome-related organelles complex-1, subunit 1; BLOC subunit 1; BLOC-1 subunit 1; BLOC1S1; BLOS1; BORCS1; GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 1; GCN5 general control of amino acid synthesis-like 1; GCN5 general control of amino-acid synthesis 5-like 1; Gcn5l1; GCN5-like protein 1; general control of amino acid synthesis, yeast homolog-like 1; general control of amino acid synthesis-like 1; MICoA; MTA1-interacting coactivator; Protein RT14; RT14; si:dkey-102c8.4; Unknown (protein for MGC:137062)
• Common Name: BLOC1S1
• Gene Symbol: Bloc1s1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining