Invitrogen™ Human Bit1 (aa 42-178) Control Fragment Recombinant Protein

Product Code. 30210115

Brand: Invitrogen™ RP90283

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82473 (PA5-82473. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a mitochondrial protein with two putative domains, an N-terminal mitochondrial localization sequence, and a UPF0099 domain. In vitro assays suggest that this protein possesses peptidyl-tRNA hydrolase activity, to release the peptidyl moiety from tRNA, thereby preventing the accumulation of dissociated peptidyl-tRNA that could reduce the efficiency of translation. This protein also plays a role regulating cell survival and death. It promotes survival as part of an integrin-signaling pathway for cells attached to the extracellular matrix characterized by intellectual disability, postnatal microcephaly, progressive cerebellar atrophy, hearing impairment, polyneuropathy, failure to thrive, and organ fibrosis with exocrine pancreas insufficiency. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9Y3E5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51651
• Name: Human Bit1 (aa 42-178) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A230072I16Rik; Bcl-2 inhibitor of transcription; bcl-2 inhibitor of transcription 1; BIT1; CFAP37; CGI-147; cilia and flagella associated protein 37; IMNEPD; OTTHUMP00000205936; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; PTH; PTH 2; Pth2; Ptrh2; RGD1306819
• Common Name: Bit1
• Gene Symbol: Ptrh2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining