Invitrogen™ Human BIN1 (aa 488-593) Control Fragment Recombinant Protein

Product Code. 30210342

Brand: Invitrogen™ RP102278

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82120 (PA5-82120. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described.

Specifications

• Accession Number: O00499
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 274
• Name: Human BIN1 (aa 488-593) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALP-1; AMPH 2; Amph2; amphiphysin 2; amphiphysin II; amphiphysin IIamph2; amphiphysin-like; amphiphysin-like protein; AMPHL; Bin1; box dependant MYC interacting protein 1; box-dependent myc-interacting protein 1; BRAMP-2; bridging integrator 1; DKFZp547F068; MGC10367; MGC105358; myc box dependent interacting protein 1; myc box-dependent-interacting protein 1; SH3 domain-containing protein 9; SH3P9; similar to bridging integrator 1 isoform 9
• Common Name: BIN1
• Gene Symbol: BIN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining