Invitrogen™ Human BIKE (aa 491-586) Control Fragment Recombinant Protein

Product Code. 30210039

Brand: Invitrogen™ RP95066

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55314 (PA5-55314. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The phosphorylation and dephosphorylation of proteins on serine and threonine residues is an essential means of regulating a broad range of cellular functions in eukaryotes, including cell division, homeostasis and apoptosis. A group of proteins that are intimately involved in this process are the serine/threonine (Ser/Thr) protein kinases. BMP2K (BMP2 inducible kinase), also known as BIKE, is a 1,161 amino acid nuclear protein that contains one protein kinase domain and belongs to the Ser/Thr protein kinase family. Thought to be involved in osteoblast differentiation, BMP2K catalyzes the ATP-dependent phosphorylation of bone morphogenic proteins (BMPs); proteins that are essential for proper cartilage and bone formation. Via its catalytic activity, BMP2K may play a role in signaling pathways that mediate bone growth and cellular differentiation. Three isoforms of BMP2K exist due to alternative splicing events.

Specifications

• Accession Number: Q9NSY1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55589
• Name: Human BIKE (aa 491-586) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933417M22Rik; AA673486; AV128808; BIKE; Bike kinase; BMP2 inducible kinase; BMP-2 inducible kinase; BMP-2-inducible protein kinase; Bmp2k; HRIHFB2017
• Common Name: BIKE
• Gene Symbol: BMP2K
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining