Invitrogen™ Human BHMG1 (aa 228-325) Control Fragment Recombinant Protein

Product Code. 30211871

Brand: Invitrogen™ RP100861

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61997 (PA5-61997. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BHMG1 gene ontology annotations related to this gene include DNA binding; protein dimerization activity.

Specifications

• Accession Number: C9JSJ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 388553
• Name: Human BHMG1 (aa 228-325) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: basic helix-loop-helix and HMG box domain containing 1; basic helix-loop-helix and HMG box domain-containing protein 1; basic helix-loop-helix and HMG-box containing 1; BHMG1; HMG domain containing; HMGDC
• Common Name: BHMG1
• Gene Symbol: BHMG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDSCGHPRPASSSPPGDRKGGQSQLTLLDLAEDTIHCDISSCWCQGSVQDDAPFPALLAQEDVARIHFLNKTQPHPRQKLVFYDSSEDVDKGSLDADP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining