Invitrogen™ Human BHLHA9 (aa 63-138) Control Fragment Recombinant Protein

Product Code. 30199227

Brand: Invitrogen™ RP103460

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64042 (PA5-64042. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative transcription factor, which may play a role in limb development.

Specifications

• Accession Number: Q7RTU4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 727857
• Name: Human BHLHA9 (aa 63-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A830053O21Rik; basic helix-loop-helix family member a9; basic helix-loop-helix family, member a9; bHLHa9; bHLHf42; class A basic helix-loop-helix protein 9; Class B basic helix-loop-helix factor 42; class F basic helix-loop-helix factor 42; class II basic helix-loop-helix protein; Fingerin; novel helix-loop-helix DNA-binding domain containing protein; Orphan1a; wu:fb99e06
• Common Name: BHLHA9
• Gene Symbol: BHLHA9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining