missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BFSP2 (aa 57-136) Control Fragment Recombinant Protein

Product Code. 30205391
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205391

Brand: Invitrogen™ RP107208

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84577 (PA5-84577. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, the protein product of this gene (phakinin), and filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene have been associated with juvenile-onset, progressive cataracts and Dowling-Meara epidermolysis bullosa simplex.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13515
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8419
Name Human BFSP2 (aa 57-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 49 kDa cytoskeletal protein; AI448593; beaded filament protein CP49; beaded filament structural protein 2; beaded filament structural protein 2, phakinin; bfps2, Cytoskeletal protein, 49-kD; BFSP2; CP 47; CP47; CP49; CTRCT12; DKEYP-73D8.2; hypothetical protein LOC494090; lens fiber cell beaded filament protein CP 47; Lens fiber cell beaded filament protein CP 49; lens intermediate filament-like light; LIFL-L; MGC142078; MGC142080; phakinin; PHAKOSIN; zgc:103750
Common Name BFSP2
Gene Symbol BFSP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.