Invitrogen™ Human BEX2 (aa 55-97) Control Fragment Recombinant Protein

Product Code. 30181069

Brand: Invitrogen™ RP99265

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139964 (PA5-139964. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the brain expressed X-linked gene family. The encoded protein interacts with the transcription factor LIM domain only 2 in a DNA-binding complex that recognizes the E-box element and promotes transcription. This gene has been found to be a tumor suppressor that is silenced in human glioma. In breast cancer cells, this gene product modulates apoptosis in response to estrogen and tamoxifen, and enhances the anti-proliferative effect of tamoxifen. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9BXY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84707
• Name: Human BEX2 (aa 55-97) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BEX1; BEX2; brain expressed X-linked 2; brain-expressed X-linked protein 2; DJ79P11.1; hBex2; protein BEX2; RP1-79P11.1
• Common Name: BEX2
• Gene Symbol: BEX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining