Invitrogen™ Human beta-Arrestin 2 (aa 79-109) Control Fragment Recombinant Protein

Product Code. 30197287

Brand: Invitrogen™ RP107446

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Beta-arrestin-2, or ARRB2, is an adaptor protein belonging to the arrestin family with an N- arrestin domain and a C- arrestin domain. ARRB2 is a regulatory protein involved in heterotrimeric G protein-coupled receptor desensitization and is known to regulate beta2-adrenergic receptor (beta2AR) function by enhancing beta2AR mediated nuclear translocation of ERK. ARRB2 binds to phosphorylated beta2ARs, thereby causing a significant impairment of their capacity to activate G(S) proteins. Along with AIP4, ARRB2 acts as an endosomal sorting molecule that mediates CXCR4 entry into a degradative pathway. It may also be involved in hormone-specific desensitization of TSH receptors. ARRB2 is a Ca2+ binding protein of the retinal outer segments and binds to P-rhodopsin and is also involved in synaptic transmission in photoreceptor cells. It is widely expressed in most of the tissues, especially neuronal tissues and spleen.

Specifications

• Accession Number: P32121
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 409
• Name: Human beta-Arrestin 2 (aa 79-109) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI326910; ARB2; ARR2; ARRB2; arrestin 3; arrestin beta 2; arrestin beta-2; arrestin, beta 2; arrestin-3; AW122872; BARR2; BARRES; beta arr2; beta-arrestin 2 long isoform; beta-arrestin 2 short isoform; beta-arrestin-2; Non-visual arrestin-3
• Common Name: beta-Arrestin 2
• Gene Symbol: ARRB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLFIATYQAFPPVPNPPRPPTRLQDRLLRKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining