Invitrogen™ Human beta-2 Adrenergic Receptor (aa 327-413) Control Fragment Recombinant Protein

Product Code. 30213049

Brand: Invitrogen™ RP102337

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adrenergic receptors (ARs) are members of the 7-transmembrane domain G-protein-coupled receptor superfamily that bind the endogenous catecholamines epinephrine and norepinephrine. Pharmacological, structural, and molecular cloning data indicate significant heterogeneity within this receptor family. Nine receptor subtypes have been identified thus far including three alpha-1 AR subtypes (1A/D, 1B, and 1C), three alpha-2 ARs (2A, 2B, and 2C), and three beta AR subtypes (1, 2, and 3). ARs participate in either the onset or maintenance of several disease states including hypertension, cardiac dysfunction (congestive heart failure, ischemia, arrhythmias), diabetes, glaucoma, depression, and impotence.

Specifications

• Accession Number: P07550
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 154
• Name: Human beta-2 Adrenergic Receptor (aa 327-413) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Adrb2; Adrb-2; ADRB2R; ADRBR; Adrenergic beta 2- receptor surface; adrenergic receptor beta 2; adrenergic receptor, beta 2; adrenergic, beta-2, receptor, surface; adrenergic, beta-2-, receptor, surface; adrenoceptor beta 2; adrenoceptor beta 2 surface; adrenoceptor beta 2, surface; AR beta2; B2AR; Badm; BAR; beta 2-AR; beta-2 adrenergic receptor; Beta-2 adrenoceptor; beta-2 adrenoreceptor; beta-2-adrenergic receptor; beta2-adrenergic receptor; beta2-Adrenoreceptor; BETA2AR; catecholamine receptor; Gpcr7; HGNC:286
• Common Name: beta-2 Adrenergic Receptor
• Gene Symbol: Adrb2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining