Invitrogen™ Human beta-2 Adaptin (aa 577-628) Control Fragment Recombinant Protein

Product Code. 30210816

Brand: Invitrogen™ RP108535

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Clathrin-mediated endocytosis is the pathway by which many receptors for nutrients and hormones are internalized to be recycled or down-regulated. During formation of clathrin coated membranes, clathrin co-assembles with heterotetrameric molecules known as assembly polypeptides (APs) or adaptors which form a layer of protein coat between the clathrin lattice and the membrane. There are two characterized adaptors AP1 and AP2. AP1 is associated with clathrin coated vesicles at the trans-Golgi network and AP2 is associated with the endocytic clathrin coated vesicles at the plasma membrane and has been shown to specifically interact with Shc and EGF receptor. AP2 is composed of four subunits, two separate ∽100 kDa gene products with similar domain structures (alpha and beta adaptin) and a ∽50 and ∽17 kDa subunit. There are two alpha-adaptin genes, alpha A and alpha C which have a tissue specific pattern of expression.

Specifications

• Accession Number: P63010
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 163
• Name: Human beta-2 Adaptin (aa 577-628) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300012O03Rik; adapter-related protein complex 1 subunit beta-1; adapter-related protein complex 2 beta subunit; adapter-related protein complex 2 subunit beta; adaptin, beta 2 (beta); adaptor protein complex AP-1 subunit beta-1; Adaptor protein complex AP-2 subunit beta; adaptor related protein complex 2 beta 1 subunit; adaptor related protein complex 2 subunit beta 1; adaptor related protein complex 2, beta 1 subunit; adaptor-related protein complex 1 subunit beta-1; Adaptor-related protein complex 2 subunit beta; adaptor-related protein complex 2, beta 1 subunit; ADTB2; AI788979; AP-1 complex subunit beta-1; AP105B; AP-2 complex subunit beta; Ap2b1; AP2-BETA; beta adaptin; beta-1-adaptin; beta1-adaptin; Beta-2-adaptin; beta2-adaptin; beta-adaptin; Beta-adaptin 1; CLAPB1; Clathrin assembly protein complex 1 beta large chain; clathrin assembly protein complex 2 beta large chain; clathrin-associated / assembly / adaptor protein, large, beta 1; clathrin-associated/assembly/adaptor; clathrin-associated/assembly/adaptor protein, large, beta 1; golgi adaptor HA1/AP1 adaptin beta subunit; Plasma membrane adaptor HA2/AP2 adaptin beta subunit; testicular tissue protein Li 22
• Common Name: beta-2 Adaptin
• Gene Symbol: AP2B1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining