missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181864

Invitrogen™ Human Bestrophin 2 (aa 412-487) Control Fragment Recombinant Protein

Product Code. 30181864
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181864

Brand: Invitrogen™ RP98318

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111228 (PA5-111228. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Best2 forms calcium-sensitive chloride channels and is permeable to bicarbonate. The Best2 gene is a member of the bestrophin gene family of anion channels. Bestrophin genes share a similar gene structure with highly conserved exon-intron boundaries, but with distinct 3' ends. Bestrophins are transmembrane proteins that contain a homologous region rich in aromatic residues, including an invariant arg-phe-pro motif. Mutation in the Best2 gene is associated with vitelliform macular dystrophy. The Best2 gene is mainly expressed in the retinal pigment epithelium and colon. Diseases associated with BEST2 include Vitelliform Macular Dystrophy and Bestrophinopathy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NFU1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54831
Name Human Bestrophin 2 (aa 412-487) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BEST2; bestrophin 2; bestrophin-2; Hbest2; vitelliform macular dystrophy 2-like 1; vitelliform macular dystrophy 2-like protein 1; VMD2L1; VMD2L-1; VMD2-like gene 1
Common Name Bestrophin 2
Gene Symbol BEST2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.