Invitrogen™ Human BERP Control Fragment Recombinant Protein

Produktkod. 30181472

Brand: Invitrogen™ RP98385

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83656 (PA5-83656. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the tripartite motif family, also called the 'RING-B-box-coiled-coil' subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified.

Specifikationer

• Accession Number: O75382
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10612
• Name: Human BERP Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Berp; BERP1; brain expressed ring finger; brain-expressed RING finger protein; Hac1; RING finger protein 22; RING finger protein 97; RING finger protein HAC1; RNF22; RNF97; Trim3; tripartite motif containing 3; tripartite motif protein 3; tripartite motif protein TRIM3; tripartite motif-containing 3; tripartite motif-containing protein 3
• Common Name: BERP
• Gene Symbol: TRIM3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVAT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining