Invitrogen™ Human BEND6 (aa 150-220) Control Fragment Recombinant Protein

Product Code. 30202363

Brand: Invitrogen™ RP104957

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65753 (PA5-65753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a corepressor of recombining binding protein suppressor hairless (RBPJ) and inhibits Notch signaling in neural stem cells, thereby opposing their self-renewal and promoting neurogenesis (PubMed:23571214).

Specifications

• Accession Number: Q5SZJ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 221336
• Name: Human BEND6 (aa 150-220) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B230209C24Rik; BEN domain containing 6; BEN domain-containing protein 6; BEN domain-containing protein 6-like; BEND6; C6orf65; RGD1310392
• Common Name: BEND6
• Gene Symbol: BEND6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSNSNSSSPVSLKPEEEHQTDEKQFQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHSLTGAKSSTSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining