Invitrogen™ Human BDNF (aa 20-149) Control Fragment Recombinant Protein

Product Code. 30195607

Brand: Invitrogen™ RP105033

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BDNF (Brain-Derived Neurotrophic Factor) is a member of the neurotrophin family. BDNF is synthesized as pre-proBDNF, followed by cleavage to proBDNF. Although further processing generates the mature, 14 kDa protein, pro-BDNF is biologically active and is secreted in synaptic vesicles along with the mature form. BDNF is widely expressed in the central nervous system and acts in an autocrine and paracrine manner on several classes of neurons. Signaling occurs mainly through the tyrosine kinase receptor TrkB, although binding to the lower-affinity receptor, p75-NTR, has also been demonstrated. BDNF promotes neuronal survival and differentiation and has been shown to play a critical role in memory formation and synaptic regulation. BDNF is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of BDNF is reduced in both Alzheimer's and Huntington disease patients, and may also play a role in the regulation of stress response and in the biology of mood disorders.

Specifications

• Accession Number: P23560
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 627
• Name: Human BDNF (aa 20-149) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: abrineurin; ANON2; anorexia BDNF; Bdnf; BDNF precursor form; bdnf protein; brain derived neurothrophic factor; brain derived neurotrophic factor; brain-derived neurotrophic factor; BULN2; H-BDNF; neurotrophin; ProBDNF
• Common Name: BDNF
• Gene Symbol: BDNF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining