missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BDH1 (aa 64-136) Control Fragment Recombinant Protein

Codice prodotto. 30195835
Click to view available options
Quantity:
100 μL
Dimensione della confezione:
100µL
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 30195835

Marca: Invitrogen™ RP106882

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66196 (PA5-66196. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the short-chain dehydrogenase/reductase gene family. The encoded protein forms a homotetrameric lipid-requiring enzyme of the mitochondrial membrane and has a specific requirement for phosphatidylcholine for optimal enzymatic activity. The encoded protein catalyzes the interconversion of acetoacetate and -3-hydroxybutyrate, the two major ketone bodies produced during fatty acid catabolism. Alternatively spliced transcript variants encoding the same protein have been described.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q02338
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 622
Name Human BDH1 (aa 64-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias (R)-3-hydroxybutyrate dehydrogenase; 2310032J20Rik; 3-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase (heart, mitochondrial); 3-hydroxybutyrate dehydrogenase, type 1; AI327223; Bdh; Bdh1; b-hydroxybutyrate dehydrogenase; D-beta-hydroxybutyrate dehydrogenase, mitochondrial; MGC2723; MGC4347; MGC9788; SDR9C1; Short chain dehydrogenase/reductase family 9 C member 1; short chain dehydrogenase/reductase family 9 C, member 1
Common Name BDH1
Gene Symbol BDH1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.