Invitrogen™ Human BCR (aa 2-75) Control Fragment Recombinant Protein

Product Code. 30202582

Brand: Invitrogen™ RP96534

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83413 (PA5-83413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The translocation produces a fusion protein which is encoded by sequence from both BCR and ABL, the gene at the chromosome 9 breakpoint. Although the BCR-ABL fusion protein has been extensively studied, the function of the normal BCR gene product is not clear. The protein has serine/threonine kinase activity and is a GTPase-activating protein for p21rac. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P11274
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 613
• Name: Human BCR (aa 2-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5133400C09Rik; ABL; AI561783; AI853148; ALL; BCR; BCR activator of RhoGEF and GTPase; BCR protein; BCR, RhoGEF and GTPase activating protein; bcr/abl; BCR/FGFR1 chimera protein; BCR1; breakpoint cluster region; breakpoint cluster region homolog; breakpoint cluster region protein; c-ABL; c-abl oncogene 1; CML; D22S11; D22S662; EC 2.7.11.1; FGFR1/BCR chimera protein; JTK7; Kiaa3017; mKIAA3017; p150; PHL; renal carcinoma antigen NY-REN-26; RP11-83J21.1; v-abl
• Common Name: Bcr
• Gene Symbol: Bcr
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining