Invitrogen™ Human BCO2 (aa 404-485) Control Fragment Recombinant Protein

Product Code. 30203108

Brand: Invitrogen™ RP109002

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140101 (PA5-140101. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BCDO2 catalyzes the asymmetric oxidative cleavage of beta-carotene in carotene metabolism.

Specifications

• Accession Number: Q9BYV7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83875
• Name: Human BCO2 (aa 404-485) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ab2-079; b,b-carotene-9',10'-dioxygenase; BCDO2; Bcmo2; Bco2; B-diox-II; beta,beta-carotene 9',10'-dioxygenase variant 1; beta,beta-carotene 9',10'-dioxygenase variant 2; beta,beta-carotene 9',10'-dioxygenase variant 3; beta,beta-carotene 9',10'-oxygenase; beta-carotene 9', 10'-dioxygenase 2; beta-carotene 9',10' oxygenase; beta-carotene 9',10'-dioxygenase 2; beta-carotene dioxygenase 2; beta-carotene oxygenase 2; beta-diox-II; carotenoid 9',10' monooxygenase II; carotenoid 9',10' monoxygenase II; carotenoid-9',10'-cleaving dioxygenase; CMO2
• Common Name: BCO2
• Gene Symbol: BCO2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining