Invitrogen™ Human BCL9 (aa 380-499) Control Fragment Recombinant Protein

Product Code. 30196474

Brand: Invitrogen™ RP92561

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54174 (PA5-54174. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BCL9 is involved in signal transduction through the Wnt pathway. It promotes beta-catenin's transcriptional activity. BCL9 is associated with B-cell acute lymphoblastic leukemia. The overexpression of BCL9 may be of pathogenic significance in B-cell malignancies.

Specifications

• Accession Number: O00512
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 607
• Name: Human BCL9 (aa 380-499) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610202E01Rik; 8030475K17Rik; A330041G23Rik; B cell CLL/lymphoma 9; B-cell CLL/lymphoma 9; B-cell CLL/lymphoma 9 protein; B-cell lymphoma 9 protein; BCL9; bcl-9; Gm130; LGS; nuclear co-factor of beta-catenin signalling; protein legless homolog
• Common Name: BCL9
• Gene Symbol: BCL9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGPGPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFYEEKRRKQEQVVVQQCSLQD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining