Invitrogen™ Human BCL7B (aa 161-202) Control Fragment Recombinant Protein

Product Code. 30212205

Brand: Invitrogen™ RP100917

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65587 (PA5-65587, PA5-63518 (PA5-63518. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Positive regulator of apoptosis. Plays a role in the Wnt signaling pathway, negatively regulating the expression of Wnt signaling components CTNNB1 and HMGA1. Involved in cell cycle progression, maintenance of the nuclear structure and stem cell differentiation. May play a role in lung tumor development or progression.

Specifications

• Accession Number: Q9BQE9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9275
• Name: Human BCL7B (aa 161-202) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B cell CLL/lymphoma 7 B; B-cell CLL/lymphoma 7 protein family member B; B-cell CLL/lymphoma 7 B; BCL tumor suppressor 7 B; Bcl7b; Hom s 3
• Common Name: BCL7B
• Gene Symbol: BCL7B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining