Invitrogen™ Human BCL6 (aa 257-385) Control Fragment Recombinant Protein

Product Code. 30207594

Brand: Invitrogen™ RP102500

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82180 (PA5-82180. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bcl-6 proto-oncogene product (a Kruppel-type zinc-finger protein) is mainly expressed in normal germinal center B cells and related lymphomas. Bcl-6 is involved in chromosome rearrangements at 3q27 in non-Hodgkin's lymphomas and Bcl-6 rearrangements have been detected in 33%-45% of diffuse large B cell lymphomas. Bcl-6 has been detected immunohistochemically in follicular lymphomas, diffuse large B cell lymphomas, Burkitt's lymphomas and in nodular, lymphocyte predominant Hodgkin's disease.

Specifications

• Accession Number: P41182
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 604
• Name: Human BCL6 (aa 257-385) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B cell CLL/lymphoma 6; B cell leukemia/lymphoma 6; B-cell CLL/lymphoma 6; B-cell CLL/lymphoma 6 (zinc finger protein 51); B-cell leukemia/lymphoma 5; B-cell leukemia/lymphoma 6; B-cell lymphoma 5 protein; B-cell lymphoma 5 protein (BCL5); B-cell lymphoma 6 protein; B-cell lymphoma 6 protein homolog; B-cell lymphoma 6 protein transcript; BCL5; BCL-5; Bcl6; Bcl-6; BCL6 transcription repressor; BCL6A; cys his2 zinc finger transcription factor; cys-his2 zinc finger transcription factor; LAZ3; LAZ-3 protein; Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3); lymphoma-associated zinc finger gene on chromosome 3; protein LAZ-3; ZBTB27; zinc finger and BTB domain-containing protein 27; Zinc finger and BTB domain-containing protein 27 (ZBTB27); Zinc finger protein 51; Zinc Finger Protein 51 (ZNF51); zinc finger transcription factor BCL6S; ZNF51
• Common Name: BCL6
• Gene Symbol: BCL6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining