Invitrogen™ Human Bcl-X (aa 1-70) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30200389	100 μL	100µL

Product Code. 30200389 Supplier Invitrogen™ Supplier No. RP102677

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded the BCL-X gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator.

Specifications

• Accession Number: Q07817
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 598
• Name: Human Bcl-X (aa 1-70) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: anti-apoptosis regulatory protein; anti-apoptotic Bcl-2 gene family member; anti-apoptotic Bcl-xL; anti-apoptotic regulator Bcl-xL; apoptosis regulator Bcl-X; B cell lymphoma 2 like; B cell lymphoma like X; B-cell leukemia/lymphoma x; Bcl 2 like 1; bcl x; Bcl xL; BCL XL/S; Bcl(X)L; bcl-2 L1; BCL2 like 1; BCL2L; Bcl2l1; bcl2-L-1; BCL2-like 1; Bcl-2-like protein 1; BCL2-like protein 1; BCLX; bcl-x; Bcl-x long protein; BclxL; Bcl-xL; BCL-XL/S; BclXS; bcl-xS; BLC2L; DKFZp781P2092; PPP1R52; protein phosphatase 1, regulatory subunit 52; RP5-857M17.3; unnamed protein product
• Common Name: BCL-X
• Gene Symbol: BCL2L1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining