Invitrogen™ Human Bcl-B (aa 1-33) Control Fragment Recombinant Protein

Product Code. 30182172

Brand: Invitrogen™ RP98457

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111149 (PA5-111149. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway.

Specifications

• Accession Number: Q9HD36
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10017
• Name: Human Bcl-B (aa 1-33) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA420380; anti-apoptotic protein Boo; Anti-apoptotic protein NrH; apoptosis regulator Bcl-B; AU023065; Bcl-2 homolog Diva; BCL2 like 10; BCL2L10; bcl2-L-10; Bcl2-like 10; BCL2-like 10 (apoptosis facilitator); bcl-2-like protein 10; BCLB; BCL-B; Boo; C85687; death inducer binding to vBcl-2 and Apaf-1; Diva
• Common Name: Bcl-B
• Gene Symbol: BCL2L10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVDQLRERTTMADPLRERTELLLADYLGYCARE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining