Invitrogen™ Human BCAT2 (aa 1-66) Control Fragment Recombinant Protein

Artikelnummer. 30182190

missing translation for 'mfr': Invitrogen™ RP98983

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62914 (PA5-62914. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene.

Spezifikation

• Accession Number: O15382
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 587
• Name: Human BCAT2 (aa 1-66) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BCAM; BCAT(m); Bcat2; Bcat-2; Bcatm; BCT2; branched chain amino acid transaminase 2; branched chain amino acid transaminase 2, mitochondrial; branched chain amino-acid transaminase 2, mitochondrial; branched chain aminotransferase 2, mitochondrial; branched-chain-amino-acid aminotransferase, mitochondrial; Eca40; heart branched chain aminotransferase precursor encoding mitochondrial protein; mBcat; placental protein 18; PP18
• Common Name: BCAT2
• Gene Symbol: BCAT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining