Invitrogen™ Human BBX (aa 208-336) Control Fragment Recombinant Protein

Product Code. 30212631

Brand: Invitrogen™ RP103082

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62227 (PA5-62227. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BBX gene ontology annotations related to this gene include DNA binding.

Specifications

• Accession Number: Q8WY36
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56987
• Name: Human BBX (aa 208-336) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5530401J07Rik; 5730403O13Rik; Ag recognized by Treg cells 1; ARTC1; BBX; BBX high mobility group box domain containing; BBX, HMG-box containing; bobby sox homolog; bobby sox homolog (Drosophila); HBP2; HMG box transcription factor BBX; HMG box-containing protein 2; HMG-BOX transcription factor BBX; HSPC339; MDS001; x 001 protein
• Common Name: BBX
• Gene Symbol: BBX
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSMLLLAGEHALGTPEVSSGTCRPDVSESPELRQKSPLFQFAEISSSTSHSDASTKQCQTSALFQFAEISSNTSQLGGAEPVKRCGKSALFQLAEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining