Invitrogen™ Human BBS9 (aa 760-883) Control Fragment Recombinant Protein

Product Code. 30200425

Brand: Invitrogen™ RP92689

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54373 (PA5-54373. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. Required for proper BBSome complex assembly and its ciliary localization.

Specifications

• Accession Number: Q3SYG4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27241
• Name: Human BBS9 (aa 760-883) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B1; Bardet-Biedl syndrome 9; Bardet-Biedl syndrome 9 (human); bardet-Biedl syndrome 9 protein; Bardet-Biedl syndrome 9 protein homolog; BBS9; C18; D1; E130103I17Rik; EST 3159894; parathyroid hormone-responsive B1 gene protein; Parathyroid hormone-responsive B1 gene protein homolog; protein PTHB1; PTHB1; PTH-responsive osteosarcoma B1 protein; RGD1308472
• Common Name: BBS9
• Gene Symbol: BBS9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining