Invitrogen™ Human BBS7 (aa 471-561) Control Fragment Recombinant Protein

Product Code. 30201448

Brand: Invitrogen™ RP96661

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60767 (PA5-60767. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BBS7, also named as BBS2L1, is a component of the BBSome complex which is required for ciliogenesis but is dispensable for centriolar satellite function. BBS7 is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome.

Specifications

• Accession Number: Q8IWZ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55212
• Name: Human BBS7 (aa 471-561) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430406N16Rik; Bardet-Biedl syndrome 7; Bardet-Biedl syndrome 7 (human); Bardet-Biedl syndrome 7 protein; Bardet-Biedl syndrome 7 protein homolog; Bbs2l1; BBS2-like 1; BBS2-like protein 1; BBS7; FLJ10715
• Common Name: BBS7
• Gene Symbol: BBS7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining