Invitrogen™ Human BBS4 (aa 10-87) Control Fragment Recombinant Protein

Product Code. 30182194

Brand: Invitrogen™ RP98098

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58783 (PA5-58783. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BBS4 contains tetratricopeptide repeats (TPR), similar to O-linked N-acetyglucosamine transferase. Mutations in the gene encoding this protein have been observed in patients with Bardet-Biedl syndrome type 4. BBS4 may play a role in pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation.

Specifications

• Accession Number: Q96RK4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 585
• Name: Human BBS4 (aa 10-87) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW537059; AW742241; Bardet-Biedl syndrome 4; Bardet-Biedl syndrome 4 (human); Bardet-Biedl syndrome 4 homolog; Bardet-Biedl syndrome 4 protein; Bardet-Biedl syndrome 4 protein homolog; BBS4; D9Ertd464e; zgc:152964
• Common Name: BBS4
• Gene Symbol: BBS4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining