Invitrogen™ Human BBS2 (aa 429-518) Control Fragment Recombinant Protein

Product Code. 30199237

Brand: Invitrogen™ RP110130

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144883 (PA5-144883. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse and the similar phenotypes exhibited by mutations in BBS gene family members is likely due to their shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport. The protein encoded by this gene forms a multiprotein BBSome complex with six other BBS proteins.

Specifications

• Accession Number: Q9BXC9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 583
• Name: Human BBS2 (aa 429-518) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410125H22Rik; AI447581; Bardet-Biedl syndrome 2; Bardet-Biedl syndrome 2 (human); Bardet-Biedl syndrome 2 homolog; Bardet-Biedl syndrome 2 protein; Bardet-Biedl syndrome 2 protein homolog; BBS; bbs2; bbs2 protein; fb80a05; MGC20703; RP74; Unknown (protein for MGC:134372); wu:fb80a05
• Common Name: BBS2
• Gene Symbol: BBS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining