Invitrogen™ Human BBOF1 Control Fragment Recombinant Protein

Product Code. 30210213

Brand: Invitrogen™ RP109453

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140167 (PA5-140167. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Basal body protein required in multiciliate cells to align and maintain cilia orientation in response to flow. May act by mediating a maturation step that stabilizes and aligns cilia orientation. Not required to respond to planar cell polarity (PCP) or flow-based orientation cues.

Specifications

• Accession Number: Q8ND07
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80127
• Name: Human BBOF1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900006K08Rik; AI427784; basal body orientation factor 1; basal body-orientation factor 1; BBOF1; C10H14orf45; C14orf45; C8H14orf45; Ccdc176; coiled-coil domain containing 176; coiled-coil domain-containing protein 176; RGD1560978; uncharacterized protein C14orf45 homolog
• Common Name: BBOF1
• Gene Symbol: BBOF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining