Invitrogen™ Human Bax (aa 12-107) Control Fragment Recombinant Protein

Product Code. 30204611

Brand: Invitrogen™ RP95261

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110949 (PA5-110949. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BAX is a members of the Bcl-2 Family and plays an important role in regulation of apoptosis. Whereas Bcl-2 is commonly regarded as an anti-apoptotic protein, BAX is considered to have a pro-apoptotic function. Regulation of apoptosis is supposed to involve both homo- and heterodimerization of different isoforms of BAX and Bcl-2. The Bax gene encodes different isoforms including Bax alpha (21 kDa) and Bax beta (24 kDa), whereas both isoforms contain the BH1, BH2 and BH3 domains, Bax beta has a unique carboxyl terminus and does not contain a hydrophobic transmembrane domain. Bcl-2 is also expressed in different Isoforms. Bcl-2 beta differs in the 3' UTR and coding region compared to variant alpha. Bcl-2 beta is shorter (22 kDa) and has a distinct C-terminus compared to Bcl-2 alpha (26 kDa). BAX is a member of the BCL-2 family of proteins, which function as regulators of apoptosis. Overexpression of BAX functions to promote cell death. BAX can form homodimers and is also able to heterodimerize with other BCL-2 related proteins.

Specifications

• Accession Number: Q07812
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 581
• Name: Human Bax (aa 12-107) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: apoptosis regulator BAX; Apoptosis regulator Bcl-X; Bax; Bax zeta; BAX-ALPHA; Bax-alpha protein; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; BCL2 associated x protein; BCL2 associated X, apoptosis regulator; BCL2 like 1; BCL2-associated protein; Bcl-2-associated protein Bax; Bcl2-associated protein Bax; Bcl-2-associated x protein; BCL2-associated x protein; BCL2-associated x protein omega; BCL2L; BCL2L1; Bcl2-L-1; BCL2L4; Bcl2-L-4; BCL2-like 1; bcl-2-like protein 1; Bcl-2-like protein 4; BCLX; Bcl-X; BCL-XL/S; PPP1R52; protein phosphatase 1, regulatory subunit 52
• Common Name: BAX
• Gene Symbol: BAX
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining