missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210567

Invitrogen™ Human BATF (aa 76-118) Control Fragment Recombinant Protein

Product Code. 30210567
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210567

Brand: Invitrogen™ RP104061

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64192 (PA5-64192. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BATF is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events and blocks cellular transformation by Ras and Fos. BATF also is required for the differentiation of IL-17-producing T helper (TH17) cells, a CD4+ subset of T cells that coordinates the inflammatory response in host defense. In both T cells and B cells, BATF is required for the appropriate regulation of the class-switch recombination.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16520
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10538
Name Human BATF (aa 76-118) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias activating transcription factor B; basic leucine zipper ATF-like transcription factor; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcription factor-like; basic leucine zipper transcriptional factor ATF-like; BATF; B-ATF; BATF1; B-cell activating transcription factor; B-cell-activating transcription factor; SFA2; SFA-2; SF-HT-activated gene 2 protein; si:ch211-153j24.4
Common Name BATF
Gene Symbol Batf
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.