Invitrogen™ Human BARHL1 (aa 36-171) Control Fragment Recombinant Protein

Product Code. 30194318

Brand: Invitrogen™ RP102508

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52114 (PA5-52114. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BARHL1 (BarH Like Homeobox 1) is a Protein Coding gene. Diseases associated with BARHL1 include Deafness, Autosomal Recessive 27 and Deafness, Autosomal Dominant 16. Gene Ontology (GO) annotations related to this gene include sequence-specific DNA binding and proximal promoter DNA-binding transcription activator activity, RNA polymerase II-specific. An important paralog of this gene is BARHL2.

Specifications

• Accession Number: Q9BZE3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56751
• Name: Human BARHL1 (aa 36-171) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Bar-class homeodomain protein MBH2; BarH like homeobox 1; BARHL1; Barhl2; BarH-like 1 (Drosophila); barH-like 1 homeobox protein; BarH-like 2; BarH-like homeobox 1; barH-related homeobox protein 1; Bh x 1; Dres115; FKSG31; Mbh2; PKCdeltaVIII
• Common Name: BARHL1
• Gene Symbol: BARHL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining