missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194080

Invitrogen™ Human BAP29 (aa 179-239) Control Fragment Recombinant Protein

Product Code. 30194080
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194080

Brand: Invitrogen™ RP103052

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62029 (PA5-62029. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bap29 and the related protein Bap31 are endoplasmic reticulum (ER) and ER-vesicle membrane proteins and members of the B-cell receptor-associated protein family. These two proteins are highly homologous and can form homo- and heterodimers. Both Bap29 and Bap31 interact with membrane-bound immunoglobulins (mIgs), such as IgM and IgD, which with Ig-alpha/Ig-beta heterodimers form B cell antigen receptors. Binding of the Bap29/Bap31 heterodimer correlates with the ER retention of non-Ig-alpha/Ig-beta bound mIg complexes, suggesting that Bap29 and Bap31 may act as chaperones transmembrane regions of various proteins. Bap29 possesses multiple isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UHQ4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55973
Name Human BAP29 (aa 179-239) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW208404; B cell receptor associated protein 29; BAP29; Bcap29; B-cell receptor-associated protein 29; B-cell receptor-associated protein BAP29; BCR-associated protein 29
Common Name BAP29
Gene Symbol Bcap29
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.