Invitrogen™ Human BAP1 (aa 522-616) Control Fragment Recombinant Protein

Product Code. 30196245

Brand: Invitrogen™ RP105016

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111420 (PA5-111420. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BRCA1-associated protein-1, or BAP1, interacts with the RING finger domain of BRCA1. The N-terminal 240 amino acids of the predicted 729-amino acid human protein show homology to ubiquitin C-terminal hydrolases (UCHs), thiol proteases that catalyze proteolytic processing of ubiquitin. In addition, BAP1 contains an acidic region, a highly charged C-terminal region, and 2 putative nuclear localization signals. BAP1 and BRCA1 associate in vivo and have overlapping subnuclear localization patterns. BAP1 enhances BRCA1-mediated inhibition of breast cancer cell growth. Northern blot analysis indicates that BAP1 is expressed as a 4-kb mRNA in all human tissues tested, with A 4. 8-kb transcript expressed exclusively in testis. Northern blot analysis and in situ hybridization reveal that BAP1 and BRCA1 are coexpressed during murine breast development and remodeling. The BAP1 gene has been mapped to 3p21. 3, a region of loss of heterozygosity for breast cancer as well as frequently deleted in lung carcinomas. Intragenic homozygous rearrangements and deletions of BAP1 appear in lung carcinoma cell lines. It has been postulated that BAP1 is a tumor suppressor gene that functions in the BRCA1 growth control pathway.

Specifications

• Accession Number: Q92560
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8314
• Name: Human BAP1 (aa 522-616) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2300006C11Rik; AA989761; AW553466; BAP1; Brca1 associated protein 1; BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase); BRCA1-associated protein 1; Cerebral protein 6; cerebral protein-13; DKFZp686N04275; FLJ35406; FLJ37180; HUCEP-13; hucep-6; KIAA0272; mKIAA0272; Ubiquitin carboxyl-terminal hydrolase BAP1; ubiquitin C-terminal hydrolase X4; UCHL2; uch-x4
• Common Name: BAP1
• Gene Symbol: BAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining