Invitrogen™ Human Band 3 (aa 158-261) Control Fragment Recombinant Protein

Product Code. 30201605

Brand: Invitrogen™ RP90912

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53326 (PA5-53326. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Band 3 protein is the most abundant integral protein of human erythrocyte membranes and functions as the major anion transporter polypeptide of erythrocytes. Band 3 is a 90-100 kDa protein, its microheterogeneity is ascribed mainly to the structural heterogeneity of the carbohydrate moiety. The C-terminal portion of the molecule spans the membrane several times, and is responsible for anion transport. The N-terminal portion, comprising almost half of the polypeptide chain of Band 3, is located inside the red cell and interacts with cytoskeletal and cytoplasmic proteins such as ankyrin.

Specifications

• Accession Number: P02730
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6521
• Name: Human Band 3 (aa 158-261) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AE 1; AE1; anion exchange protein 1; anion exchanger 1; anion exchanger-1; band 3 anion transport protein; BND3; CAMP; CD233; CHC; DI; Diego blood group; EMPB3; EPB3; erythrocyte membrane protein band 3; erythroid anion exchange protein; FR; Froese blood group; l11Jus51; MEB3; MGC116750; MGC116753; MGC126619; MGC126623; RTA1A; SAO; Slc4a1; solute carrier family 4 (anion exchanger), member 1; solute carrier family 4 (anion exchanger), member 1 (Diego blood group); solute carrier family 4 member 1; solute carrier family 4 member 1 (Diego blood group); solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group); solute carrier family 4, anion exchanger, number 1; Solute carrier family 4, member 1, anion exchange protein 1 (kidney band 3); SPH4; SW; Swann blood group; Waldner blood group; WD; WD1; WR; Wright blood group; ZNF828
• Common Name: Band 3
• Gene Symbol: SLC4A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining