Invitrogen™ Human BAIAP2 (aa 210-294) Control Fragment Recombinant Protein

Product Code. 30196676

Brand: Invitrogen™ RP93437

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82976 (PA5-82976. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Specifications

• Accession Number: Q9UQB8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10458
• Name: Human BAIAP2 (aa 210-294) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BAI1 associated protein 2; BAI1-associated protein 2; BAIAP2; BAI-associated protein 2; BAP2; brain-specific angiogenesis inhibitor 1-associated protein 2; Fas ligand-associated factor 3; FLAF3; insulin receptor substrate 53; insulin receptor substrate of 53 kDa; insulin receptor substrate p53; insulin receptor substrate p53/p58; Insulin receptor substrate protein of 53 kDa; insulin receptor tyrosine kinase 53 kDa substrate; Insulin receptor tyrosine kinase substrate protein p53; IRS-58; IRSp53; IRSp53/58; R75030
• Common Name: BAIAP2
• Gene Symbol: BAIAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining